PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10028642m
Common NameCARUB_v10028642mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 205aa    MW: 23635.7 Da    PI: 9.7086
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10028642mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-161360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W +eEd +l+ +v+ +G g+W+ I+r+ g++R +k+c++rw +yl
  Carubv10028642m 13 RGLWKPEEDMILKSYVETHGEGNWADISRRSGLKRGGKSCRLRWKNYL 60
                     788*****************************99************97 PP

2Myb_DNA-binding51.81.8e-1666111148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++++E++l+++ +k+lG++ W++Ia +++ gRt++++k++w+++l
  Carubv10028642m  66 RGSMSPQEQDLIIRMHKLLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 111
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.392860IPR017930Myb domain
SMARTSM007172.9E-141262IPR001005SANT/Myb domain
SuperFamilySSF466894.77E-2912107IPR009057Homeodomain-like
PfamPF002491.6E-141360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-221467IPR009057Homeodomain-like
CDDcd001671.24E-101660No hitNo description
PROSITE profilePS5129425.72961115IPR017930Myb domain
SMARTSM007174.9E-1665113IPR001005SANT/Myb domain
PfamPF002494.8E-1566111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-2468114IPR009057Homeodomain-like
CDDcd001673.20E-1168111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010026Biological Processtrichome differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MEQKREGKSY VKRGLWKPEE DMILKSYVET HGEGNWADIS RRSGLKRGGK SCRLRWKNYL  60
RPNIKRGSMS PQEQDLIIRM HKLLGNRWSL IAGRLPGRTD NEVKNYWNTH LNKKSNSRKQ  120
NAPESIAATT CTDKPVISTE VRRSHGEEGD GEEKSMARNT WMEETNSFDY DVRIGSPLPL  180
ISHYPDNTLV FDPCFAFTDF YPLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-241111425127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196370.0AY519637.1 Arabidopsis thaliana MYB transcription factor (At5g52600) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006282345.11e-153hypothetical protein CARUB_v10028642mg
SwissprotQ9LTF71e-130MYB82_ARATH; Transcription factor MYB82
TrEMBLR0GVN81e-153R0GVN8_9BRAS; Uncharacterized protein
STRINGAT5G52600.11e-128(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52600.11e-131myb domain protein 82